PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0232.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YC
Protein Properties Length: 273aa    MW: 29737 Da    PI: 5.1183
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0232.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC56.75.3e-186861898
                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++++P arikki++adedv +i+  +Pvl+ska elf+ +l   ++  + ++  +t+    ++ +v+r  ifdfl ++v +
  Kaladp0060s0232.1.p  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDMTYGITVQTGAKTVSSLHLKHCVQRYSIFDFLKEVVNK 86
                         5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.9E-24372IPR009072Histone-fold
SuperFamilySSF471133.05E-19490IPR009072Histone-fold
PfamPF008087.1E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDMT YGITVQTGAK  60
TVSSLHLKHC VQRYSIFDFL KEVVNKVPDY THSGTSGEVQ TISRRRKGAG DELSDSDEYS  120
KRSRLQEAVP GVGGGRGRGR GRGRGRGRGR VGHVAEPDDA QNDFEPESSA VNLDAIQANN  180
NNKGRELPSD FKGDGDGLTN PVVGKFDLNT EIKEKESTPS LATDDKVSAH SAIQSENAEL  240
GISEMDRMNF NPLQLGSMKS TFDDDEDYDD DG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-21272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139148RGRGRGRGRG
2139149RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432367.11e-74hypothetical protein CICLE_v10002081mg
RefseqXP_006471322.11e-74PREDICTED: dr1-associated corepressor
TrEMBLV4SXS01e-74V4SXS0_9R
STRINGVIT_13s0084g00040.t011e-67(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.14e-64nuclear factor Y, subunit C11